Polyclonal Rabbit anti-Human GLRX / Glutaredoxin Antibody (IHC, IF, WB) LS-C333977

Artikelnummer: LS-C333977-100

Bilder (2)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human GLRX / Glutaredoxin Antibody (IHC, IF, WB) LS-C333977
Artikelnummer:	LS-C333977-100
Hersteller Artikelnummer:	LS-C333977-100
Alternativnummer:	LS-C333977-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IF, IHC, WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1-106 of human GLRX (NP_001112362.1). MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ
Konjugation:	Unconjugated
Alternative Synonym:	GLRX, Glutaredoxin-1, Glutaredoxin, GRX1, Thioltransferase-1, GRX, TTase-1

Glutaredoxin antibody LS-C333977 is an unconjugated rabbit polyclonal antibody to Glutaredoxin (GLRX) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.

Klonalität:	Polyclonal
NCBI:	2745
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 11kDa, while the observed MW by Western blot was 12kDa.

	Western blot analysis of extracts of various cel
	Immunofluorescence analysis of MCF-7 cell using GLRX antibody. Blue: DAPI for nuclear staining.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten