Polyclonal Rabbit anti-Human DAP Antibody (IHC, IF, WB) LS-C334527

Artikelnummer: LS-C334527-20

Bilder (3)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human DAP Antibody (IHC, IF, WB) LS-C334527
Artikelnummer:	LS-C334527-20
Hersteller Artikelnummer:	LS-C334527-20
Alternativnummer:	LS-C334527-20
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IF, IHC, WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human DAP (NP_004385.1). MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK
Konjugation:	Unconjugated
Alternative Synonym:	DAP, DAP-1, Death-associated protein 1, DAP1, Death-associated protein

DAP antibody LS-C334527 is an unconjugated rabbit polyclonal antibody to DAP from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.

Klonalität:	Polyclonal
NCBI:	1611
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IF (1:20 - 1:100), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 11kDa, while the observed MW by Western blot was 15kDa.

	Western blot analysis of extracts of various cell lines.
	Immunohistochemistry of paraffin-embedded rat kidney tissue.
	Immunofluorescence analysis of MCF-7 cells.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten