Polyclonal Rabbit anti-Human P2RY4 / P2Y4 Antibody (IHC, WB) LS-C335292

Artikelnummer: LS-C335292-100
Artikelname: Polyclonal Rabbit anti-Human P2RY4 / P2Y4 Antibody (IHC, WB) LS-C335292
Artikelnummer: LS-C335292-100
Hersteller Artikelnummer: LS-C335292-100
Alternativnummer: LS-C335292-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 286-365 of human P2RY4 (NP_002556.1). VVYKVTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAATPQDSSCSTPRADRL
Konjugation: Unconjugated
Alternative Synonym: P2RY4, p2Y4, p2P, p2Y purinoceptor 4, Pyrimidinergic receptor p2ry4, NRU, Uridine nucleotide receptor, p2RY4, UNR
P2Y4 antibody LS-C335292 is an unconjugated rabbit polyclonal antibody to P2Y4 (P2RY4) from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Klonalität: Polyclonal
NCBI: 5030
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IHC (1:50 - 1:100), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 40kDa, while the observed MW by Western blot was 41kDa.
Western blot analysis of extracts of various cells.
Immunohistochemistry of paraffin-embedded Human lung cancer tissue.