Polyclonal Rabbit anti-Human GHRH Antibody (IHC, WB) LS-C335562

Artikelnummer: LS-C335562-100
Artikelname: Polyclonal Rabbit anti-Human GHRH Antibody (IHC, WB) LS-C335562
Artikelnummer: LS-C335562-100
Hersteller Artikelnummer: LS-C335562-100
Alternativnummer: LS-C335562-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-107 of human GHRH (NP_001171660.1). PPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHRNSQG
Konjugation: Unconjugated
Alternative Synonym: GHRH, INN, Sermorelin, Somatocrinin, Somatoliberin, Somatorelin, GHRF, GRF
GHRH antibody LS-C335562 is an unconjugated rabbit polyclonal antibody to GHRH from human. It is reactive with human and mouse. Validated for IHC and WB.
Klonalität: Polyclonal
NCBI: 2691
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IHC (1:50 - 1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 12kDa, while the observed MW by Western blot was 15kDa.
Western blot analysis of extracts of various cell lines.
Immunohistochemistry of paraffin-embedded human liver cancer tissue.