Polyclonal Rabbit anti-Human Apolipoprotein C-I Antibody (IHC, WB) LS-C335595

Artikelnummer: LS-C335595-100
Artikelname: Polyclonal Rabbit anti-Human Apolipoprotein C-I Antibody (IHC, WB) LS-C335595
Artikelnummer: LS-C335595-100
Hersteller Artikelnummer: LS-C335595-100
Alternativnummer: LS-C335595-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human APOC1 (NP_001636.1). MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Konjugation: Unconjugated
Alternative Synonym: APOC1, Apo-c1, Apo-CI, Apo-CIB, ApoC-I, Apolipoprotein C-I, ApoC-IB, APOC1B, Apolipoprotein C1, Apolipoprotein CI
Apolipoprotein C-I antibody LS-C335595 is an unconjugated rabbit polyclonal antibody to Apolipoprotein C-I from human. It is reactive with human and rat. Validated for IHC and WB.
Klonalität: Polyclonal
NCBI: 341
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: IHC (1:50 - 1:100), WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 9kDa, while the observed MW by Western blot was Refer to Figures.
Western blot analysis of extracts of Recombinant Protein cells.
Immunohistochemistry of paraffin-embedded rat liver tissue.