Polyclonal Rabbit anti-Human UCN2 / SRP Antibody (IHC, IF, WB) LS-C335681

Artikelnummer: LS-C335681-100

Bilder (3)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human UCN2 / SRP Antibody (IHC, IF, WB) LS-C335681
Artikelnummer:	LS-C335681-100
Hersteller Artikelnummer:	LS-C335681-100
Alternativnummer:	LS-C335681-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	IF, IHC, WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 20-112 of human UCN2 (NP_149976.1). VPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC
Konjugation:	Unconjugated
Alternative Synonym:	UCN2, SRP, Ucn II, UCN-II, UCNI, Urocortin 2, UR, Urocortin-related peptide, Stresscopin-related peptide, Urocortin II, Urocortin-2, URP

SRP antibody LS-C335681 is an unconjugated rabbit polyclonal antibody to SRP (UCN2) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.

Klonalität:	Polyclonal
NCBI:	90226
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	IF (1:50 - 1:100), IHC (1:50 - 1:100), WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 12kDa, while the observed MW by Western blot was 12kDa.

	Western blot analysis of extracts of rat skin cells.
	Immunohistochemistry of paraffin-embedded mouse heart.
	Immunofluorescence analysis of U2OS cells.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten