Polyclonal Rabbit anti-Human SLC17A7 / VGLUT1 Antibody (WB) LS-C747949

Artikelnummer: LS-C747949-20

Bilder (0)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human SLC17A7 / VGLUT1 Antibody (WB) LS-C747949
Artikelnummer:	LS-C747949-20
Hersteller Artikelnummer:	LS-C747949-20
Alternativnummer:	LS-C747949-20
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	WB
Spezies Reaktivität:	Human, Mouse
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 461-560 of human SLC17A7 (NP_064705.1). KHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDDSEMEDEAEPPGAPPAPPPSYGATHSTFQPPRPPPPVRDY
Konjugation:	Unconjugated
Alternative Synonym:	SLC17A7, BNPI, VGLUT1

VGLUT1 antibody LS-C747949 is an unconjugated rabbit polyclonal antibody to VGLUT1 (SLC17A7) from human. It is reactive with human and mouse. Validated for WB.

Klonalität:	Polyclonal
NCBI:	57030
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	WB (1:200 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 53kDa/59kDa/61kDa, while the observed MW by Western blot was 50kDa.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten