Polyclonal Rabbit anti-Human ST6GALNAC4 Antibody (WB) LS-C747950

Artikelnummer: LS-C747950-100

Bilder (0)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human ST6GALNAC4 Antibody (WB) LS-C747950
Artikelnummer:	LS-C747950-100
Hersteller Artikelnummer:	LS-C747950-100
Alternativnummer:	LS-C747950-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	WB
Spezies Reaktivität:	Human, Mouse
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 120-210 of human ST6GALNAC4 (NP_778204.1). TLRVVSHTSVPLLLRNYSHYFQKARDTLYMVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSF
Konjugation:	Unconjugated
Alternative Synonym:	ST6GALNAC4, Sialyltransferase 3C, Sialyltransferase 7D, SIAT3-C, SIAT7-D, SIAT3C, ST6GalNAc IV, ST6GALNACIV, SIAT7D

ST6GALNAC4 antibody LS-C747950 is an unconjugated rabbit polyclonal antibody to ST6GALNAC4 from human. It is reactive with human and mouse. Validated for WB.

Klonalität:	Polyclonal
NCBI:	27090
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	WB (1:1000 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 34kDa, while the observed MW by Western blot was 34kDa.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten