Polyclonal Rabbit anti-Human TDRD1 Antibody (WB) LS-C747953

Artikelnummer: LS-C747953-20
Artikelname: Polyclonal Rabbit anti-Human TDRD1 Antibody (WB) LS-C747953
Artikelnummer: LS-C747953-20
Hersteller Artikelnummer: LS-C747953-20
Alternativnummer: LS-C747953-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-125 of human TDRD1 (NP_942090.1). PFNFEKNENKLPPHESLRSPGTLPNHPNFRLKSSENGNKKNNFLLCEQTKQYLASQEDNSVSSNPNGINGEVVGSKGDRKKLPAGNSVSPPSAESNSPPKE
Konjugation: Unconjugated
Alternative Synonym: TDRD1, Cancer/testis antigen 41.1, CT41.1, Tudor domain containing 1
TDRD1 antibody LS-C747953 is an unconjugated rabbit polyclonal antibody to TDRD1 from human. It is reactive with human and mouse. Validated for WB.
Klonalität: Polyclonal
NCBI: 56165
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:1000 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 79kDa/119kDa/132kDa, while the observed MW by Western blot was 130kDa.