Polyclonal Rabbit anti-Human FCER1G Antibody (WB) LS-C747959

Artikelnummer: LS-C747959-20
Artikelname: Polyclonal Rabbit anti-Human FCER1G Antibody (WB) LS-C747959
Artikelnummer: LS-C747959-20
Hersteller Artikelnummer: LS-C747959-20
Alternativnummer: LS-C747959-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-86 of human FCER1G (NP_004097.1). LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Konjugation: Unconjugated
Alternative Synonym: FCER1G, FceRI gamma, IgE Fc receptor subunit gamma, FcRgamma, Gamma polypeptide, Fc receptor gamma-chain, Fc-epsilon RI-gamma, FCRG
FCER1G antibody LS-C747959 is an unconjugated rabbit polyclonal antibody to FCER1G from human. It is reactive with human, mouse and rat. Validated for WB.
Klonalität: Polyclonal
NCBI: 2207
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:1000 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 9kDa, while the observed MW by Western blot was 12kDa.