Polyclonal Rabbit anti-Human GPR55 Antibody (WB) LS-C747960

Artikelnummer: LS-C747960-100

Bilder (0)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human GPR55 Antibody (WB) LS-C747960
Artikelnummer:	LS-C747960-100
Hersteller Artikelnummer:	LS-C747960-100
Alternativnummer:	LS-C747960-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 210-319 of human GPR55 (NP_005674.2). GRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG
Konjugation:	Unconjugated
Alternative Synonym:	GPR55, G-protein coupled receptor 55, G protein-coupled receptor 55

GPR55 antibody LS-C747960 is an unconjugated rabbit polyclonal antibody to GPR55 from human. It is reactive with human, mouse and rat. Validated for WB.

Klonalität:	Polyclonal
Konzentration:	2.86 mg/ml
NCBI:	9290
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 36kDa, while the observed MW by Western blot was 40kDa.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten