Polyclonal Rabbit anti-Human SDS Antibody (WB) LS-C747968

Artikelnummer: LS-C747968-100
Artikelname: Polyclonal Rabbit anti-Human SDS Antibody (WB) LS-C747968
Artikelnummer: LS-C747968-100
Hersteller Artikelnummer: LS-C747968-100
Alternativnummer: LS-C747968-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 90-170 of human SDS (NP_006834.2). TTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGG
Konjugation: Unconjugated
Alternative Synonym: SDS, L-serine ammonia-lyase, L-serine dehydratase, Serine dehydratase, SDH, TDH, L-serine deaminase, L-threonine dehydratase
SDS antibody LS-C747968 is an unconjugated rabbit polyclonal antibody to SDS from human. It is reactive with human, mouse and rat. Validated for WB.
Klonalität: Polyclonal
NCBI: 10993
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 34kDa, while the observed MW by Western blot was 35kDa.