Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human RUFY3 (NP_055776.1). MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLM
Konjugation:
Unconjugated
Alternative Synonym:
RUFY3, KIAA0871, Protein RUFY3, Rap2 interacting protein x, Rap2-interacting protein x, RIPX, Single axon-regulated protein, SINGAR1, Singar, Single axon-related 1
RIPX antibody LS-C747969 is an unconjugated rabbit polyclonal antibody to RIPX (RUFY3) from human. It is reactive with human, mouse and rat. Validated for WB.
