Polyclonal Rabbit anti-Human RUFY3 / RIPX Antibody (WB) LS-C747969

Artikelnummer: LS-C747969-20
Artikelname: Polyclonal Rabbit anti-Human RUFY3 / RIPX Antibody (WB) LS-C747969
Artikelnummer: LS-C747969-20
Hersteller Artikelnummer: LS-C747969-20
Alternativnummer: LS-C747969-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human RUFY3 (NP_055776.1). MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLM
Konjugation: Unconjugated
Alternative Synonym: RUFY3, KIAA0871, Protein RUFY3, Rap2 interacting protein x, Rap2-interacting protein x, RIPX, Single axon-regulated protein, SINGAR1, Singar, Single axon-related 1
RIPX antibody LS-C747969 is an unconjugated rabbit polyclonal antibody to RIPX (RUFY3) from human. It is reactive with human, mouse and rat. Validated for WB.
Klonalität: Polyclonal
NCBI: 22902
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 52kDa/55kDa/64kDa/70kDa, while the observed MW by Western blot was 53kDa.