Polyclonal Rabbit anti-Human AKT3 Antibody (WB) LS-C747979

Artikelnummer: LS-C747979-20
Artikelname: Polyclonal Rabbit anti-Human AKT3 Antibody (WB) LS-C747979
Artikelnummer: LS-C747979-20
Hersteller Artikelnummer: LS-C747979-20
Alternativnummer: LS-C747979-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 93-154 of human AKT3 (NP_859029.1). EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL
Konjugation: Unconjugated
Alternative Synonym: AKT3, AKT3/PKBgamma, PRKBG, PKB gamma, Protein kinase Akt-3, RAC-gamma, MPPH, PKB-GAMMA, PKBG, Protein kinase B gamma, RAC-PK-gamma, STK-2
AKT3 antibody LS-C747979 is an unconjugated rabbit polyclonal antibody to AKT3 from human. It is reactive with human, mouse and rat. Validated for WB.
Klonalität: Polyclonal
NCBI: 10000
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 54kDa/55kDa, while the observed MW by Western blot was 60kDa.