Polyclonal Rabbit anti-Human CLU / Clusterin Antibody (WB) LS-C747981

Artikelnummer: LS-C747981-100

Bilder (0)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human CLU / Clusterin Antibody (WB) LS-C747981
Artikelnummer:	LS-C747981-100
Hersteller Artikelnummer:	LS-C747981-100
Alternativnummer:	LS-C747981-100
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	WB
Spezies Reaktivität:	Human, Mouse, Rat
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human CLU (NP_001822.3). DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQT
Konjugation:	Unconjugated
Alternative Synonym:	CLU, APO-J, Apolipoprotein J, CLU1, Clusterin, Complement lysis inhibitor, CLI, AAG4, Aging-associated protein 4, Ku70-binding protein 1, KUB1, SGP2, APOJ, SGP-2, Sulfated glycoprotein 2, CLU2, Complement cytolysis inhibitor, NA1/NA2, SP-40

Clusterin antibody LS-C747981 is an unconjugated rabbit polyclonal antibody to Clusterin (CLU) from human. It is reactive with human, mouse and rat. Validated for WB.

Klonalität:	Polyclonal
NCBI:	1191
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 32kDa/48kDa/52kDa/53kDa/57kDa, while the observed MW by Western blot was 35kDa.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten