Polyclonal Rabbit anti-Human ENOX1 / CNOX Antibody (WB) LS-C749286

Artikelnummer: LS-C749286-100
Artikelname: Polyclonal Rabbit anti-Human ENOX1 / CNOX Antibody (WB) LS-C749286
Artikelnummer: LS-C749286-100
Hersteller Artikelnummer: LS-C749286-100
Alternativnummer: LS-C749286-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 450-560 of human ENOX1 (NP_060463.2). LKQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQ
Konjugation: Unconjugated
Alternative Synonym: ENOX1, CCNOX, CNOX, PIG38, BA64J21.1, Constitutive Ecto-NOX
CNOX antibody LS-C749286 is an unconjugated rabbit polyclonal antibody to CNOX (ENOX1) from human. It is reactive with human and mouse. Validated for WB.
Klonalität: Polyclonal
NCBI: 55068
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 27kDa/73kDa, while the observed MW by Western blot was 73kDa.