Polyclonal Rabbit anti-Human RXFP2 / LGR8 Antibody (WB) LS-C749303

Artikelnummer: LS-C749303-20
Artikelname: Polyclonal Rabbit anti-Human RXFP2 / LGR8 Antibody (WB) LS-C749303
Artikelnummer: LS-C749303-20
Hersteller Artikelnummer: LS-C749303-20
Alternativnummer: LS-C749303-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human RXFP2 (NP_570718.1). CGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKETELECVNGDLKSVPMISNNVTLLSLKKNKIHSLPDKVFIKYTKLKKIFLQHNCIRHISRKA
Konjugation: Unconjugated
Alternative Synonym: RXFP2, G-protein coupled receptor 106, GPR106, INSL3R, LGR8, GREAT, Relaxin receptor 2, LGR8.1, RXFPR2
LGR8 antibody LS-C749303 is an unconjugated rabbit polyclonal antibody to LGR8 (RXFP2) from human. It is reactive with human, mouse and rat. Validated for WB.
Klonalität: Polyclonal
NCBI: 122042
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 83kDa/86kDa, while the observed MW by Western blot was 89kDa.