Polyclonal Rabbit anti-Human BAFF Receptor / CD268 Antibody (WB) LS-C749304

Artikelnummer: LS-C749304-20
Artikelname: Polyclonal Rabbit anti-Human BAFF Receptor / CD268 Antibody (WB) LS-C749304
Artikelnummer: LS-C749304-20
Hersteller Artikelnummer: LS-C749304-20
Alternativnummer: LS-C749304-20
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TNFRSF13C (NP_443177.1). MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFG
Konjugation: Unconjugated
Alternative Synonym: TNFRSF13C, BAFFR, BR3, BAFF receptor, BLyS receptor 3, CD268, CD268 antigen, CVID4, BAFF-R, BROMIX
CD268 antibody LS-C749304 is an unconjugated rabbit polyclonal antibody to CD268 (BAFF Receptor) from human. It is reactive with human and mouse. Validated for WB.
Klonalität: Polyclonal
NCBI: 115650
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 18kDa, while the observed MW by Western blot was 19kDa.