Polyclonal Rabbit anti-Human BAFF Receptor / CD268 Antibody (WB) LS-C749304

Artikelnummer: LS-C749304-20

Bilder (0)
Sehen Sie alle Bilder und Bildinformationen

Artikelname:	Polyclonal Rabbit anti-Human BAFF Receptor / CD268 Antibody (WB) LS-C749304
Artikelnummer:	LS-C749304-20
Hersteller Artikelnummer:	LS-C749304-20
Alternativnummer:	LS-C749304-20
Hersteller:	LifeSpan Biosciences
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	WB
Spezies Reaktivität:	Human, Mouse
Immunogen:	Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human TNFRSF13C (NP_443177.1). MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFG
Konjugation:	Unconjugated
Alternative Synonym:	TNFRSF13C, BAFFR, BR3, BAFF receptor, BLyS receptor 3, CD268, CD268 antigen, CVID4, BAFF-R, BROMIX

CD268 antibody LS-C749304 is an unconjugated rabbit polyclonal antibody to CD268 (BAFF Receptor) from human. It is reactive with human and mouse. Validated for WB.

Klonalität:	Polyclonal
NCBI:	115650
Puffer:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit:	Affinity purified
Formulierung:	PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Verdünnung:	WB (1:500 - 1:2000)
Anwendungsbeschreibung:	The predicted MW is 18kDa, while the observed MW by Western blot was 19kDa.

* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten