Polyclonal Rabbit anti-Human RAB12 Antibody (WB) LS-C749323

Artikelnummer: LS-C749323-100
Artikelname: Polyclonal Rabbit anti-Human RAB12 Antibody (WB) LS-C749323
Artikelnummer: LS-C749323-100
Hersteller Artikelnummer: LS-C749323-100
Alternativnummer: LS-C749323-100
Hersteller: LifeSpan Biosciences
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human RAB12 (NP_001020471.2). MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEA
Konjugation: Unconjugated
Alternative Synonym: RAB12, Ras-related protein Rab-12
RAB12 antibody LS-C749323 is an unconjugated rabbit polyclonal antibody to RAB12 from human. It is reactive with human and mouse. Validated for WB.
Klonalität: Polyclonal
Konzentration: 3.54 mg/ml
NCBI: 201475
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Reinheit: Affinity purified
Formulierung: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Application Verdünnung: WB (1:500 - 1:2000)
Anwendungsbeschreibung: The predicted MW is 27kDa, while the observed MW by Western blot was 36kDa.