STAT6 Antibody, Rabbit, Polyclonal

Artikelnummer: NSJ-R32096
Artikelname: STAT6 Antibody, Rabbit, Polyclonal
Artikelnummer: NSJ-R32096
Hersteller Artikelnummer: R32096
Alternativnummer: NSJ-R32096
Hersteller: NSJ Bioreagents
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Amino acids ESIYQRDPLKLVATFRQILQGEKKAVMEQFR of human STAT6 were used as the immunogen for the STAT6 antibody.
STAT6 is a human gene. The protein encoded by this gene is a member of the STAT family of transcription factors. The gene spans 19 kb and contains 23 exons. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2), expression of cell surface markers, and class switch of immunoglobulins.
Klonalität: Polyclonal
UniProt: P42226
Puffer: Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Reinheit: Antigen affinity
Formulierung: 0.5mg/ml if reconstituted with 0.2ml sterile DI water
Antibody Type: Primary Antibody
Application Verdünnung: Western blot: 0.1-0.5ug/ml
Anwendungsbeschreibung: Optimal dilution of the STAT6 antibody should be determined by the researcher.