GDF9 Antibody, Clone: [GDF9/4261], Mouse, Monoclonal

Artikelnummer: NSJ-V8671-100UG
Artikelname: GDF9 Antibody, Clone: [GDF9/4261], Mouse, Monoclonal
Artikelnummer: NSJ-V8671-100UG
Hersteller Artikelnummer: V8671-100UG
Alternativnummer: NSJ-V8671-100UG
Hersteller: NSJ Bioreagents
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Amino acids VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from the C-terminal region of human GDF9 were used as the immunogen for the GDF9 antibody. The epitope has been mapped to amino acids EPDG.
GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
Klonalität: Monoclonal
Klon-Bezeichnung: [GDF9/4261]
UniProt: O60383
Reinheit: Protein G affinity chromatography
Formulierung: 0.2 mg/ml in 1X PBS with 0.1 mg/ml BSA (US sourced) and 0.05% sodium azide
Antibody Type: Primary Antibody
Application Verdünnung: ELISA: order Ab without BSA for coating,Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml for 30 minutes at RT
Anwendungsbeschreibung: Optimal dilution of the GDF9 antibody should be determined by the researcher.