APPBP2 (KIAA0228, PAT1, Amyloid Protein-binding Protein 2, Amyloid beta Precursor Protein-binding Protein 2, Protein Interacting with APP Tail 1) (MaxLight 490), Clone: [4C2], Mouse, Monoclonal

Artikelnummer: USB-123449-ML490
Artikelname: APPBP2 (KIAA0228, PAT1, Amyloid Protein-binding Protein 2, Amyloid beta Precursor Protein-binding Protein 2, Protein Interacting with APP Tail 1) (MaxLight 490), Clone: [4C2], Mouse, Monoclonal
Artikelnummer: USB-123449-ML490
Hersteller Artikelnummer: 123449-ML490
Alternativnummer: USB-123449-ML490-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, WB
Immunogen: Partial recombinant corresponding to aa486-585 from APPBP2 (NP_006371) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)490 is a new Blue-Green photostable dye conjugate comparable to DyLight(TM)488, Alexa Fluor(TM)488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm), Emission (515nm), Extinction Coefficient 73,000. The protein encoded by this gene interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimers disease. This gene has been found to be highly expressed in breast cancer. Multiple polyadenylation sites have been found for this gene. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDVSTSPQSTEEVVQSFLISQNVEGPSC Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [4C2]
NCBI: 006380
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)490.