NAA10 (ARD1, N-alpha-acetyltransferase 10, N-terminal Acetyltransferase Complex ARD1 Subunit Homolog A, NatA Catalytic Subunit, ARD1A, TE2, DXS707, MGC71248) (APC), Rabbit

Artikelnummer: USB-123463-APC
Artikelname: NAA10 (ARD1, N-alpha-acetyltransferase 10, N-terminal Acetyltransferase Complex ARD1 Subunit Homolog A, NatA Catalytic Subunit, ARD1A, TE2, DXS707, MGC71248) (APC), Rabbit
Artikelnummer: USB-123463-APC
Hersteller Artikelnummer: 123463-APC
Alternativnummer: USB-123463-APC-100
Hersteller: US Biological
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human ARD1A, aa1-235 (NP_003482.1).
In complex with NAA15, displays alpha (N-terminal) acetyltransferase activity. Without NAA15, displays epsilon (internal) acetyltransferase activity towards HIF1A, thereby promoting its degradation. Represses MYLK kinase activity by acetylation, and thus represses tumor cell migration. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
NCBI: 003491
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).