PCF11 (Pre-mRNA Cleavage Complex 2 Protein Pcf11, Pre-mRNA Cleavage Complex II Protein Pcf11, KIAA0824), Clone: [3G4], Mouse, Monoclonal

Artikelnummer: USB-130985
Artikelname: PCF11 (Pre-mRNA Cleavage Complex 2 Protein Pcf11, Pre-mRNA Cleavage Complex II Protein Pcf11, KIAA0824), Clone: [3G4], Mouse, Monoclonal
Artikelnummer: USB-130985
Hersteller Artikelnummer: 130985
Alternativnummer: USB-130985-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: Partial recombinant corresponding to aa1465-1555 from human PCF11 (NP_056969) partial recombinant with GST tag. MW of the GST tag alone is 26kD.
Component of pre-mRNA cleavage complex II. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENPLNIMLNIVKNELQEPCDSPKVKEERIDTPPACTEESIATPSEIKTENDTVESV Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Klonalität: Monoclonal
Klon-Bezeichnung: [3G4]
NCBI: 015885
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.