PCGF6 (MBLR, RNF134, Polycomb Group RING Finger Protein 6, Mel18 and Bmi1-like RING Finger, RING Finger Protein 134, MGC15678, MGC17541), Mouse

Artikelnummer: USB-130990
Artikelname: PCGF6 (MBLR, RNF134, Polycomb Group RING Finger Protein 6, Mel18 and Bmi1-like RING Finger, RING Finger Protein 134, MGC15678, MGC17541), Mouse
Artikelnummer: USB-130990
Hersteller Artikelnummer: 130990
Alternativnummer: USB-130990-50
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: WB
Immunogen: Full length human PCGF6, aa1-277 (AAH07602.1).
The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1. PcG proteins are known to form protein complexes and function as transcription repressors. This protein has been shown to interact with some PcG proteins and act as a transcription repressor. The activity of this protein is found to be regulated by cell cycle dependent phosphorylation. Alternatively spliced transcript variants encoding different isoforms have been identified. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEGVAVVTAGSVGAAKTEGAAALPPPPPPPVSPPALTPAPAAGEEGPAPLSETGAPGCSGSRPPELEPERSLGRFRGRFEDEDEELEEEEELEEEEEEEEEDMSHFSLRLEGGRQDSEDEEERLINLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLEQYQTLREIRRAIGDAAMQDGLLVLHYGLVVSPLKIT Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 007602
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2.