PCGF6 (MBLR, RNF134, Polycomb Group RING Finger Protein 6, Mel18 and Bmi1-like RING Finger, RING Finger Protein 134, MGC15678, MGC17541) (MaxLight 650), Clone: [2B8], Mouse, Monoclonal

Artikelnummer: USB-130991-ML650
Artikelname: PCGF6 (MBLR, RNF134, Polycomb Group RING Finger Protein 6, Mel18 and Bmi1-like RING Finger, RING Finger Protein 134, MGC15678, MGC17541) (MaxLight 650), Clone: [2B8], Mouse, Monoclonal
Artikelnummer: USB-130991-ML650
Hersteller Artikelnummer: 130991-ML650
Alternativnummer: USB-130991-ML650-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA
Immunogen: Partial recombinant corresponding to aa225-325 from human PCGF6 (NP_001011663) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor(TM)647, DyLight(TM)649, Cy5(TM) and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm), Emission (676nm), Extinction Coefficient 250,000. The protein encoded by this gene contains a RING finger motif, which is most closely related to those of polycomb group (PcG) proteins RNF110/MEL-18 and BMI1. PcG proteins are known to form protein complexes and function as transcription repressors. This protein has been shown to interact with some PcG proteins and act as a transcription repressor. The activity of this protein is found to be regulated by cell cycle dependent phosphorylation. Alternatively spliced transcript variants encoding different isoforms have been identified. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AVPQPVPSSKGRSKKVLESVFRIPPELDMSLLLEFIGANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQVDIICGDHLLEQYQTLREIRR Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [2B8]
NCBI: 001011663
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)650.