WWTR1 (WW Domain-containing Transcription Regulator Protein 1, Transcriptional Coactivator with PDZ-binding Motif, TAZ) (MaxLight 550), Clone: [1F1], Mouse, Monoclonal

Artikelnummer: USB-135424-ML550
Artikelname: WWTR1 (WW Domain-containing Transcription Regulator Protein 1, Transcriptional Coactivator with PDZ-binding Motif, TAZ) (MaxLight 550), Clone: [1F1], Mouse, Monoclonal
Artikelnummer: USB-135424-ML550
Hersteller Artikelnummer: 135424-ML550
Alternativnummer: USB-135424-ML550-100
Hersteller: US Biological
Wirt: Mouse
Kategorie: Antikörper
Applikation: FLISA, IHC, WB
Immunogen: Partial recombinant corresponding to aa201-300 from human WWTR1 (NP_056287) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor(TM)546, 555, DyLight(TM)549 , Cy3(TM), TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm), Emission (575nm), Extinction Coefficient 150,000. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFL* Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Klonalität: Monoclonal
Klon-Bezeichnung: [1F1]
NCBI: 015472
Reinheit: Purified by Protein A affinity chromatography.
Formulierung: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)550.