Anti-ITLN1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10089-100
Article Name: Anti-ITLN1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10089-100
Supplier Catalog Number: A10089-100
Alternative Catalog Number: ABC-A10089-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-313 of human ITLN1 (NP_060095.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to ITLN1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 37 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFP
Target: ITLN1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200