Anti-POLD3 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10090-100
Article Name: Anti-POLD3 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10090-100
Supplier Catalog Number: A10090-100
Alternative Catalog Number: ABC-A10090-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 197-466 of human POLD3 (NP_006582.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to POLD3.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 51 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: ASKAAAKTQETNKETKTEAKEVTNASAAGNKAPGKGNMMSNFFGKAAMNKFKVNLDSEQAVKEEKIVEQPTVSVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAYEAESPSPPPPPSPPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALG
Target: POLD3
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:100, IHC: 1:100-1:500