Anti-ATR Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10092-100
Article Name: Anti-ATR Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10092-100
Supplier Catalog Number: A10092-100
Alternative Catalog Number: ABC-A10092-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 400-650 of human ATR (NP_001175.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to ATR.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 301 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: LKMESMEIIEEIQCQTQQENLSSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYSGLKNPVIEMLEGIAVVLQLTALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFYTKVLKSCRSLLESVQKLDLEATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIYSHSDDGCLKLTTFAANLLTLSCRISDSYSPQAQSRCVFLLTLFPRRIFLE
Target: ATR
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000