Anti-ACE Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
ABC-A10116-100
| Article Name: |
Anti-ACE Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
ABC-A10116-100 |
| Supplier Catalog Number: |
A10116-100 |
| Alternative Catalog Number: |
ABC-A10116-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 30-270 of human ACE (NP_690043.1). |
| Conjugation: |
Unconjugated |
| Rabbit polyclonal antibody to ACE. |
| Clonality: |
Polyclonal |
| Concentration: |
Lot Specific |
| Molecular Weight: |
110kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol. |
| Form: |
Liquid |
| Sequence: |
EASQQVTVTHGTSSQATTSSQTTTHQATAHQTSAQSPNLVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQE |
| Target: |
ACE |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:500-1:2000 |
