Anti-STAMBP Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10144-100
Article Name: Anti-STAMBP Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10144-100
Supplier Catalog Number: A10144-100
Alternative Catalog Number: ABC-A10144-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-270 of human STAMBP (NP_998787.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to STAMBP.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 48kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Form: Liquid
Sequence: FPKAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQL
Target: STAMBP
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2000, IHC: 1:50-1:200, IF: 1:50-1:100