Anti-14-3-3 zeta Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10177-100
Article Name: Anti-14-3-3 zeta Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10177-100
Supplier Catalog Number: A10177-100
Alternative Catalog Number: ABC-A10177-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 190 to the C-terminus of human YWHAZ (NP_003397.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to 14-3-3 zeta.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 28 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: SLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Target: 14-3-3 zeta
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200