Anti-CD30 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10182-100
Article Name: Anti-CD30 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10182-100
Supplier Catalog Number: A10182-100
Alternative Catalog Number: ABC-A10182-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to amino acids 500-595 of human CD30.
Conjugation: Unconjugated
Rabbit polyclonal antibody to CD30.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 128 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: LPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Target: CD30
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000