Anti-Growth Hormone Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10191-100
Article Name: Anti-Growth Hormone Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10191-100
Supplier Catalog Number: A10191-100
Alternative Catalog Number: ABC-A10191-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GH1 (NP_000506.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Growth Hormone.
Clonality: Polyclonal
Concentration: Lot Specific
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: ELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVE
Target: Growth Hormone
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200