Anti-PDGFRA Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10314-100
Article Name: Anti-PDGFRA Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10314-100
Supplier Catalog Number: A10314-100
Alternative Catalog Number: ABC-A10314-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human PDGFRA (NP_006197.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to PDGFRA.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 135kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.
Form: Liquid
Sequence: MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKA
Target: PDGFRA
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2000