Anti-NUP133 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10522-100
Article Name: Anti-NUP133 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10522-100
Supplier Catalog Number: A10522-100
Alternative Catalog Number: ABC-A10522-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 730-930 of human NUP133 (NP_060700.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to NUP133.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 133 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: NILKDMLQAASHYRQNRNSLYRREESLEKEPEYVPWTATSGPGGIRTVIIRQHEIVLKVAYPQADSNLRNIVTEQLVALIDCFLDGYVSQLKSVDKSSNRERYDNLEMEYLQKRSDLLSPLLSLGQYLWAASLAEKYCDFDILVQMCEQTDNQSRLQRYMTQFADQNFSDFLFRWYLEKGKRGKLLSQPISQHGQLANFLQ
Target: NUP133
Antibody Type: Primary Antibody
Application Dilute: WB: 1:1,000-1:2,000, ICC/IF: 1:50-1:200