Anti-Nup153 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A10581-100
Article Name: Anti-Nup153 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A10581-100
Supplier Catalog Number: A10581-100
Alternative Catalog Number: ABC-A10581-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human NUP153 (NP_005115.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Nup153.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 154 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Form: Liquid
Sequence: FQAKREKVDSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEKNMTPGQNREQRESGFSYPNFSLPAANGLSSGVGGGGGKMR
Target: Nup153
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000