Anti-liver FABP Antibody [ARC0545], Unconjugated, Rabbit, Monoclonal
Catalog Number:
ABC-A81027-100
| Article Name: |
Anti-liver FABP Antibody [ARC0545], Unconjugated, Rabbit, Monoclonal |
| Biozol Catalog Number: |
ABC-A81027-100 |
| Supplier Catalog Number: |
A81027-100 |
| Alternative Catalog Number: |
ABC-A81027-100 |
| Manufacturer: |
Antibodies.com |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ICC, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FABP1 (P07148). |
| Conjugation: |
Unconjugated |
| Rabbit monoclonal [ARC0545] antibody to liver FABP. |
| Clonality: |
Monoclonal |
| Concentration: |
Lot Specific |
| Clone Designation: |
[ARC0545] |
| Molecular Weight: |
14 kDa |
| Buffer: |
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide. |
| Form: |
Liquid |
| Sequence: |
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKS |
| Target: |
liver FABP |
| Antibody Type: |
Primary Antibody |
| Application Dilute: |
WB: 1:500-1:2,000, ICC/IF: 1:50-1:200 |
