Anti-SYCP2 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88505-100
Article Name: Anti-SYCP2 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88505-100
Supplier Catalog Number: A88505-100
Alternative Catalog Number: ABC-A88505-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1231-1530 of human SYCP2 (NP_055073.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to SYCP2.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 176 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: EIESPHINENYIQSKREESHLASSLSKSSEGREKTWFDMPCDATHVSGPTQHLSRKRIYIEDNLSNSNEVEMEEKGERRANLLPKKLCKIEDADHHIHKMSESVSSLSTNDFSIPWETWQNEFAGIEMTYETYERLNSEFKRRNNIRHKMLSYFTTQSWKTAQQHLRTMNHQSQDSRIKKLDKFQFIIIEELENFEKDSQSLKDLEKEFVDFWEKIFQKFSAYQKSEQQRLHLLKTSLAKSVFCNTDSEETVFTS
Target: SYCP2
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ICC/IF: 1:50-1:200