Anti-Kinectin 1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88510-100
Article Name: Anti-Kinectin 1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88510-100
Supplier Catalog Number: A88510-100
Alternative Catalog Number: ABC-A88510-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Kinectin 1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 178 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MEFYESAYFIVLIPSIVITVIFLFFWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKKKNKKKEIQNGNLHESDSESVPRDFKLSDALAVEDDQVAPV
Target: Kinectin 1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:200