Anti-IFITM1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88524-100
Article Name: Anti-IFITM1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88524-100
Supplier Catalog Number: A88524-100
Alternative Catalog Number: ABC-A88524-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human CD225/IFITM1 (NP_003632.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to IFITM1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 17 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: CCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY
Target: IFITM1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:200-1:2,000, IHC: 1:50-1:200