Anti-Ube2L6 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A88581-100
Article Name: Anti-Ube2L6 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A88581-100
Supplier Catalog Number: A88581-100
Alternative Catalog Number: ABC-A88581-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human UBE2L6 (NP_004214.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Ube2L6.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 18 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: AFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Target: Ube2L6
Antibody Type: Primary Antibody
Application Dilute: WB: 1:100-1:500, ICC/IF: 1:50-1:200