Anti-OAS1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A90010-100
Article Name: Anti-OAS1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A90010-100
Supplier Catalog Number: A90010-100
Alternative Catalog Number: ABC-A90010-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to amino acids 1-100 of human OAS1.
Conjugation: Unconjugated
Rabbit polyclonal antibody to OAS1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 46 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQ
Target: OAS1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, ELISA: 1 µg/ml (starting concentration)