Anti-WWOX Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A90018-100
Article Name: Anti-WWOX Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A90018-100
Supplier Catalog Number: A90018-100
Alternative Catalog Number: ABC-A90018-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ELISA, ICC, WB
Species Reactivity: Human, Mouse
Immunogen: A recombinant fusion protein corresponding to amino acids 1-120 of human WWOX.
Conjugation: Unconjugated
Rabbit polyclonal antibody to WWOX.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 46 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGR
Target: WWOX
Antibody Type: Primary Antibody
Application Dilute: WB: 1:1,000-1:2,000, ICC/IF: 1:50-1:200