Anti-Estrogen Related Receptor alpha Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A90033-100
Article Name: Anti-Estrogen Related Receptor alpha Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A90033-100
Supplier Catalog Number: A90033-100
Alternative Catalog Number: ABC-A90033-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-76 of human ESRRA (NP_004442.3).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Estrogen Related Receptor alpha.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 46 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLVLSSLPK
Target: Estrogen Related Receptor alpha
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:2,000, IHC: 1:50-1:100, ICC/IF: 1:50-1:200