Anti-Retinal S antigen Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A90119-100
Article Name: Anti-Retinal S antigen Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A90119-100
Supplier Catalog Number: A90119-100
Alternative Catalog Number: ABC-A90119-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-405 of human SAG (NP_000532.2).
Conjugation: Unconjugated
Rabbit polyclonal antibody to Retinal S antigen.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 52 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Form: Liquid
Sequence: MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYS
Target: Retinal S antigen
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000, IHC: 1:50-1:200