Anti-IL1 Receptor I/IL-1R-1 Antibody, Unconjugated, Rabbit, Polyclonal

Catalog Number: ABC-A9744-100
Article Name: Anti-IL1 Receptor I/IL-1R-1 Antibody, Unconjugated, Rabbit, Polyclonal
Biozol Catalog Number: ABC-A9744-100
Supplier Catalog Number: A9744-100
Alternative Catalog Number: ABC-A9744-100
Manufacturer: Antibodies.com
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL1R1 (NP_000868.1).
Conjugation: Unconjugated
Rabbit polyclonal antibody to IL1 Receptor I/IL-1R-1.
Clonality: Polyclonal
Concentration: Lot Specific
Molecular Weight: 80 kDa
Buffer: Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.
Form: Liquid
Sequence: MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRN
Target: IL1 Receptor I/IL-1R-1
Antibody Type: Primary Antibody
Application Dilute: WB: 1:500-1:1,000