ANXA5 monoclonal antibody (MF01J), clone 1F4-1A5 (FITC), Clone: [1F4-1A5], Mouse, Monoclonal
Catalog Number:
ABN-H00000308-MF01J
| Article Name: |
ANXA5 monoclonal antibody (MF01J), clone 1F4-1A5 (FITC), Clone: [1F4-1A5], Mouse, Monoclonal |
| Biozol Catalog Number: |
ABN-H00000308-MF01J |
| Supplier Catalog Number: |
H00000308-MF01J |
| Alternative Catalog Number: |
ABN-H00000308-MF01J-50,ABN-H00000308-MF01J-3 |
| Manufacturer: |
Abnova |
| Host: |
Mouse |
| Category: |
Antikörper |
| Application: |
FC, IF, WB |
| Species Reactivity: |
Human |
| Immunogen: |
ANXA5 (AAH01429, 1 a.a. ~ 320 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation: |
FITC |
| FITC conjugated mouse monoclonal antibody raised against a full-length recombinant ANXA5.This product is belong to Cell Culture Grade Antibody (CX Grade). |
| Clonality: |
Monoclonal |
| Clone Designation: |
[1F4-1A5] |
| UniProt: |
308 |
| Buffer: |
In 1x PBS, pH 7.4 |
| Form: |
Liquid |
| Sequence: |
MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETL |
| Target: |
ANXA5 |